Cell Signaling Kinase Enzyme Systems-continued Product Cat.# p38a Kinase Enzyme System ADP-Glo™ Kinase Assay + p38a Kinase Enzyme System p38g Kinase Enzyme System ADP-Glo™ Kinase Assay + p38g Kinase Enzyme System p70S6K Kinase Enzyme System ADP-Glo™ Kinase Assay + p70S6K Kinase Enzyme System PAK4 Kinase Enzyme System ADP-Glo™ Kinase Assay + PAK4 Kinase Enzyme System PDGFRα Kinase Enzyme System ADP-Glo™ Kinase Assay + PDGFRα Kinase Enzyme System PDGFRβ Kinase Enzyme System ADP-Glo™ Kinase Assay + PDGFRβ Kinase Enzyme System PDK1 Kinase Enzyme System ADP-Glo™ Kinase Assay + PDK1 Kinase Enzyme System PKCα Kinase Enzyme System ADP-Glo™ Kinase Assay + PKCα Kinase Enzyme System PKCβ II Kinase Enzyme System ADP-Glo™ Kinase Assay + PKCβ II Kinase Enzyme System PKCγ Kinase Enzyme System ADP-Glo™ Kinase Assay + PKCγ Kinase Enzyme System PKCδ Kinase Enzyme System ADP-Glo™ Kinase Assay + PKCδ Kinase Enzyme System PKCζ Kinase Enzyme System ADP-Glo™ Kinase Assay + PKCζ Kinase Enzyme System PKCι Kinase Enzyme System ADP-Glo™ Kinase Assay + PKCι Kinase Enzyme System PLK1 Kinase Enzyme System ADP-Glo™ Kinase Assay + PLK1 Kinase Enzyme System RET Kinase Enzyme System ADP-Glo™ Kinase Assay + RET Kinase Enzyme System ROCK1 Kinase Enzyme System ADP-Glo™ Kinase Assay + ROCK1 Kinase Enzyme System Size V2701 10µg V9591 1 each V3371 10µg V9601 1 each V2741 10µg V9611 1 each V3201 10µg V9451 1 each V3721 10µg V8011 1 each V3731 10µg V8021 1 each V2761 10µg V9681 1 each V3381 10µg V9691 1 each V3741 10µg V9701 1 each V3391 10µg V9711 1 each V3401 10µg V9721 1 each V2781 10µg V9731 1 each V3751 10µg V9751 1 each V2841 10µg V8041 1 each V3761 10µg V8061 1 each V3411 10µg V9581 1 each Kinase p38a, 10µg (Human, recombinant full-length) p38g, 10µg (Human, recombinant full-length) p70S6K, 10µg (Human, recombinant full-length) PAK4, 10µg (Human, recombinant full-length) PDGFRα, 10µg (Human, recombinant; amino acids 550-end) PDGFRβ, 10µg (Human, recombinant; amino acids 557-end) PDK1, 10µg (Human, recombinant full-length) PKCα, 10µg (Human, recombinant full-length) PKCβ II, 10µg (Human, recombinant full-length) PKCγ, 10µg (Human, recombinant full-length) PKCδ, 10µg (Human, recombinant full-length) PKCζ, 10µg (Human, recombinant full-length) PKCι, 10µg (Human, recombinant full-length) PLK1, 10µg (Human, recombinant full-length) RET, 10µg (Human, recombinant; amino acids 658-end) ROCK1, 10µg (Human, recombinant; amino acids 17-535) Molecular Weight ~67kDa ~71kDa ~76 kDa p38 peptide p38 peptide S6K substrate (KRRRLASLR); derived from human 40S ribosomal protein S6 (amino acid 230-238). ~90kDa Modifi ed AKT Substrate II peptide (modifi ed-CKRPRAASFAE); based on the N-terminus of GSK3. ~95 kDa ~104kDa Poly (4:1 Glu, Tyr) Peptide Poly (4:1 Glu, Tyr) Peptide ~67 kDa PDKtide (KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC); derived from two human proteins: residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984). ~103 kDa ~105 kDa ~105 kDa ~104 kDa ~93 kDa ~98 kDa CREBtide (KRREILSRRPSYR); derived from human CREB1 isoform A (amino acid 109-121). CREBtide (KRREILSRRPSYR); derived from human CREB1 isoform A (amino acid 109-121). PKCtide (ERMRPRKRQGSVRRRV); derived from protein kinase C epsilon (amino acid 149-164). CREBtide (KRREILSRRPSYR); derived from human CREB1 isoform A (amino acid 109-121). CREBtide (KRREILSRRPSYR); derived from human CREB1 isoform A (amino acid 109-121). CREBtide (KRREILSRRPSYR); derived from human CREB1 isoform A (amino acid 109-121). ~70kDa Casein, Dephosphorylated (Bovine) ~74 kDa ~85 kDa IGF1Rtide (KKKSPGEYVNIEFG); derived from human IRS-1 protein residues 891-902. S6K substrate (KRRRLASLR); derived from human 40S ribosomal protein S6 (amino acid 230-238). Substrate Other Reaction Buffer; DTT Reaction Buffer; DTT 3 Reaction Buffer; DTT Reaction Buffer; DTT Reaction Buffer; DTT Reaction Buffer; DTT Reaction Buffer; DTT Reaction Buffer; DTT Reaction Buffer; DTT; Lipid solution Reaction Buffer; DTT; Lipid solution Reaction Buffer; DTT; Lipid solution Reaction Buffer; DTT Reaction Buffer; DTT; Lipid solution Reaction Buffer; DTT Reaction Buffer; DTT Reaction Buffer; DTT; Lipid solution 9526LD For complete and up-to-date product information visit: www.promega.com/catalog 59 Cell Signaling Pagina 62

Pagina 64

Voor clubbladen, online archief en onderwijs magazines zie het Online Touch content management beheersysteem systeem. Met de mogelijkheid voor een online winkel in uw folders.

Promega Switzerland - Life Sciences Catalog 2012 Lees publicatie 100Home